SEC63 antibody (70R-1765)

Rabbit polyclonal SEC63 antibody

Synonyms Polyclonal SEC63 antibody, Anti-SEC63 antibody, ERdj2 antibody, PRO2507 antibody, SEC-63, Sec63 Homolog antibody, SEC 63, SEC 63 antibody, SEC63L antibody, SEC-63 antibody, SEC63
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS
Assay Information SEC63 Blocking Peptide, catalog no. 33R-10039, is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody

Images

Western Blot analysis using SEC63 antibody (70R-1765)

SEC63 antibody (70R-1765) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SEC63 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SEC63 antibody (70R-1765) | SEC63 antibody (70R-1765) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors