Selenoprotein antibody (70R-5346)

Rabbit polyclonal Selenoprotein antibody raised against the middle region of 15 kDa Selenoprotein

Synonyms Polyclonal Selenoprotein antibody, Anti-Selenoprotein antibody, 42248 antibody, 15 kDa Selenoprotein antibody
Specificity Selenoprotein antibody was raised against the middle region of 15 kDa Selenoprotein
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS
Assay Information Selenoprotein Blocking Peptide, catalog no. 33R-8360, is also available for use as a blocking control in assays to test for specificity of this Selenoprotein antibody

Images

Western Blot analysis using Selenoprotein antibody (70R-5346)

Selenoprotein antibody (70R-5346) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 42248 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Selenoprotein antibody (70R-5346) | Selenoprotein antibody (70R-5346) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors