SENP5 antibody (70R-3795)

Rabbit polyclonal SENP5 antibody raised against the middle region of SENP5

Synonyms Polyclonal SENP5 antibody, Anti-SENP5 antibody, Sumo1/Sentrin Specific Peptidase 5 antibody, SENP5, SENP-5, FLJ42398 antibody, SENP 5, MGC27076 antibody, DKFZp564O1016 antibody, SENP 5 antibody, SENP-5 antibody
Specificity SENP5 antibody was raised against the middle region of SENP5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR
Assay Information SENP5 Blocking Peptide, catalog no. 33R-5426, is also available for use as a blocking control in assays to test for specificity of this SENP5 antibody

Images

Western Blot analysis using SENP5 antibody (70R-3795)

SENP5 antibody (70R-3795) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SENP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SENP5 antibody (70R-3795) | SENP5 antibody (70R-3795) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors