SEPP1 antibody (70R-2714)

Rabbit polyclonal SEPP1 antibody raised against the N terminal of SEPP1

Synonyms Polyclonal SEPP1 antibody, Anti-SEPP1 antibody, Selenoprotein P Plasma 1 antibody, SeP antibody, SEPP-1 antibody, SEPP 1, SELP antibody, SEPP-1, SEPP1, SEPP 1 antibody
Specificity SEPP1 antibody was raised against the N terminal of SEPP1
Cross Reactivity Human
Applications WB
Immunogen SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
Assay Information SEPP1 Blocking Peptide, catalog no. 33R-4984, is also available for use as a blocking control in assays to test for specificity of this SEPP1 antibody

Western Blot analysis using SEPP1 antibody (70R-2714)

SEPP1 antibody (70R-2714) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SEPP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using SEPP1 antibody (70R-2714) | SEPP1 antibody (70R-2714) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors