Septin 11 antibody (70R-5568)

Rabbit polyclonal Septin 11 antibody raised against the N terminal of 40432

Synonyms Polyclonal Septin 11 antibody, Anti-Septin 11 antibody, Septin 11, Septin 11 antibody, Septin 11, Septin -11, 40787 antibody, Septin -11 antibody
Specificity Septin 11 antibody was raised against the N terminal of 40432
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET
Assay Information Septin 11 Blocking Peptide, catalog no. 33R-5793, is also available for use as a blocking control in assays to test for specificity of this Septin 11 antibody


Western Blot analysis using Septin 11 antibody (70R-5568)

Septin 11 antibody (70R-5568) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 40787 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Septin 11 antibody (70R-5568) | Septin 11 antibody (70R-5568) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors