Septin 2 antibody (70R-5632)

Rabbit polyclonal Septin 2 antibody raised against the N terminal of 40423

Synonyms Polyclonal Septin 2 antibody, Anti-Septin 2 antibody, DIFF6 antibody, hNedd5 antibody, Pnutl3 antibody, Septin 2, Septin 2 antibody, Septin -2, Septin 2, KIAA0158 antibody, Septin -2 antibody, NEDD5 antibody, 37500 antibody
Specificity Septin 2 antibody was raised against the N terminal of 40423
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
Assay Information Septin 2 Blocking Peptide, catalog no. 33R-6451, is also available for use as a blocking control in assays to test for specificity of this Septin 2 antibody


Western Blot analysis using Septin 2 antibody (70R-5632)

Septin 2 antibody (70R-5632) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 37500 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Septin 2 antibody (70R-5632) | Septin 2 antibody (70R-5632) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors