Septin 9 antibody (70R-3525)

Rabbit polyclonal Septin 9 antibody raised against the middle region of SEPT9

Synonyms Polyclonal Septin 9 antibody, Anti-Septin 9 antibody, SeptD1 antibody, Septin 9, MSF1 antibody, NAPB antibody, Septin -9, PNUTL4 antibody, KIAA0991 antibody, Septin 9 antibody, SINT1 antibody, AF17q25 antibody, Septin -9 antibody, 40057 antibody, MSF antibody, Septin 9
Specificity Septin 9 antibody was raised against the middle region of SEPT9
Cross Reactivity Human
Applications WB
Immunogen Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL
Assay Information Septin 9 Blocking Peptide, catalog no. 33R-9702, is also available for use as a blocking control in assays to test for specificity of this Septin 9 antibody


Western Blot analysis using Septin 9 antibody (70R-3525)

Septin 9 antibody (70R-3525) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 40057 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Septin 9 antibody (70R-3525) | Septin 9 antibody (70R-3525) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors