SERPINB5 antibody (70R-1273)

Rabbit polyclonal SERPINB5 antibody

Synonyms Polyclonal SERPINB5 antibody, Anti-SERPINB5 antibody, SERPINB-5, SERPINB5, Ovalbumin 5 antibody, SERPINB 5, SERPINB-5 antibody, PI5 antibody, Serpin Peptidase Inhibitor Clade B Member 5 antibody, SERPINB 5 antibody, maspin antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
Assay Information SERPINB5 Blocking Peptide, catalog no. 33R-6892, is also available for use as a blocking control in assays to test for specificity of this SERPINB5 antibody

Images

Immunohistochemical staining using SERPINB5 antibody (70R-1273)

SERPINB5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SERPINB5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SERPINB5 antibody (70R-1273) | SERPINB5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using SERPINB5 antibody (70R-1273) | SERPINB5 antibody (70R-1273) used at 0.625 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors