SERPIND1 antibody (70R-5267)

Rabbit polyclonal SERPIND1 antibody

Synonyms Polyclonal SERPIND1 antibody, Anti-SERPIND1 antibody, Heparin Cofactor 1 antibody, HC2 antibody, SERPIND1, Serpin Peptidase Inhibitor Clade D Member 1 antibody, HCII antibody, SERPIND 1 antibody, HLS2 antibody, SERPIND-1, SERPIND 1, HCF2 antibody, SERPIND-1 antibody, D22S673 antibody, LS2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ
Assay Information SERPIND1 Blocking Peptide, catalog no. 33R-9813, is also available for use as a blocking control in assays to test for specificity of this SERPIND1 antibody


Western Blot analysis using SERPIND1 antibody (70R-5267)

SERPIND1 antibody (70R-5267) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPIND1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SERPIND1 antibody (70R-5267) | SERPIND1 antibody (70R-5267) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors