SFN antibody (70R-5570)

Rabbit polyclonal SFN antibody raised against the middle region of SFN

Synonyms Polyclonal SFN antibody, Anti-SFN antibody, YWHAS antibody, Stratifin antibody
Specificity SFN antibody was raised against the middle region of SFN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT
Assay Information SFN Blocking Peptide, catalog no. 33R-2923, is also available for use as a blocking control in assays to test for specificity of this SFN antibody


Western blot analysis using SFN antibody (70R-5570)

Recommended SFN Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SFN antibody (70R-5570) | Recommended SFN Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors