SFRS6 antibody (70R-4617)

Rabbit polyclonal SFRS6 antibody raised against the middle region of SFRS6

Synonyms Polyclonal SFRS6 antibody, Anti-SFRS6 antibody, MGC5045 antibody, SFRS 6 antibody, B52 antibody, SFRS-6, SFRS 6, SFRS-6 antibody, Splicing Factor Arginine/Serine-Rich 6 antibody, SRP55 antibody, SFRS6
Specificity SFRS6 antibody was raised against the middle region of SFRS6
Cross Reactivity Human,Mouse
Applications WB
Immunogen SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS
Assay Information SFRS6 Blocking Peptide, catalog no. 33R-4356, is also available for use as a blocking control in assays to test for specificity of this SFRS6 antibody

Images

Western blot analysis using SFRS6 antibody (70R-4617)

Recommended SFRS6 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SFRS6 antibody (70R-4617) | Recommended SFRS6 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors