SFRS8 antibody (70R-4885)

Rabbit polyclonal SFRS8 antibody

Synonyms Polyclonal SFRS8 antibody, Anti-SFRS8 antibody, SFRS8, Suppressor-Of-White-Apricot Homolog Drosophila antibody, Splicing Factor Arginine/Serine-Rich 8 antibody, SFRS 8 antibody, SFRS 8, SFRS-8 antibody, SFRS-8, MGC167082 antibody, SWAP antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE
Assay Information SFRS8 Blocking Peptide, catalog no. 33R-5508, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Images

Western Blot analysis using SFRS8 antibody (70R-4885)

SFRS8 antibody (70R-4885) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified although their full-length natures have not been characterized to date.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SFRS8 antibody (70R-4885) | SFRS8 antibody (70R-4885) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors