SGCG antibody (70R-1772)

Rabbit polyclonal SGCG antibody

Synonyms Polyclonal SGCG antibody, Anti-SGCG antibody, MGC130048 antibody, MAM antibody, Sarcoglycan Gamma antibody, SCG3 antibody, A4 antibody, DMDA antibody, DAGA4 antibody, DMDA1 antibody, SCARMD2 antibody, 35Kda Dystrophin-Associated Glycoprotein antibody, TYPE antibody, LGMD2C antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS
Assay Information SGCG Blocking Peptide, catalog no. 33R-3107, is also available for use as a blocking control in assays to test for specificity of this SGCG antibody


Western Blot analysis using SGCG antibody (70R-1772)

SGCG antibody (70R-1772) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SGCG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SGCG antibody (70R-1772) | SGCG antibody (70R-1772) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors