SGEF antibody (70R-3508)

Rabbit polyclonal SGEF antibody raised against the N terminal of SGEF

Synonyms Polyclonal SGEF antibody, Anti-SGEF antibody, Src Homology 3 Domain-Containing RNA guanine Nucleotide Exchange Factor antibody, DKFZP434D146 antibody, CSGEF antibody, HMFN1864 antibody
Specificity SGEF antibody was raised against the N terminal of SGEF
Cross Reactivity Human
Applications WB
Immunogen SGEF antibody was raised using the N terminal of SGEF corresponding to a region with amino acids MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD
Assay Information SGEF Blocking Peptide, catalog no. 33R-5834, is also available for use as a blocking control in assays to test for specificity of this SGEF antibody


Western blot analysis using SGEF antibody (70R-3508)

Recommended ARHGEF26 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SGEF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukoc

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SGEF antibody (70R-3508) | Recommended ARHGEF26 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors