SH3BGR antibody (70R-1963)

Rabbit polyclonal SH3BGR antibody raised against the N terminal of SH3BGR

Synonyms Polyclonal SH3BGR antibody, Anti-SH3BGR antibody, SHBGR 3, SHBGR-3 antibody, 21-GARP antibody, Sh3 Domain Binding Glutamic Acid-Rich Protein antibody, SHBGR-3, SH3BGR, SHBGR 3 antibody
Specificity SH3BGR antibody was raised against the N terminal of SH3BGR
Cross Reactivity Human
Applications WB
Immunogen SH3BGR antibody was raised using the N terminal of SH3BGR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV
Assay Information SH3BGR Blocking Peptide, catalog no. 33R-1691, is also available for use as a blocking control in assays to test for specificity of this SH3BGR antibody

Images

Western Blot analysis using SH3BGR antibody (70R-1963)

SH3BGR antibody (70R-1963) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3BGR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SH3BGR antibody (70R-1963) | SH3BGR antibody (70R-1963) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors