SH3KBP1 antibody (70R-4573)

Rabbit polyclonal SH3KBP1 antibody raised against the N terminal of SH3KBP1

Synonyms Polyclonal SH3KBP1 antibody, Anti-SH3KBP1 antibody, SH3KBP1, SHKBP1-3 antibody, SHKBP1-3, GIG10 antibody, SHKBP1 3 antibody, Sh3-Domain Kinase Binding Protein 1 antibody, SHKBP1 3, MIG18 antibody, CIN85 antibody
Specificity SH3KBP1 antibody was raised against the N terminal of SH3KBP1
Cross Reactivity Human
Applications WB
Immunogen SH3KBP1 antibody was raised using the N terminal of SH3KBP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS
Assay Information SH3KBP1 Blocking Peptide, catalog no. 33R-9090, is also available for use as a blocking control in assays to test for specificity of this SH3KBP1 antibody


Western Blot analysis using SH3KBP1 antibody (70R-4573)

SH3KBP1 antibody (70R-4573) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3KBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SH3KBP1 antibody (70R-4573) | SH3KBP1 antibody (70R-4573) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors