SHB Blocking Peptide (33R-2710)

A synthetic peptide for use as a blocking control in assays to test for specificity of SHB antibody, catalog no. 70R-5762

Synonyms SHB control peptide, SHB antibody Blocking Peptide, Anti-SHB Blocking Peptide, Src Homology 2 Domain Containing Adaptor Protein B Blocking Peptide, RP11-3J10.8 Blocking Peptide, bA3J10.2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY
Molecular Weight 55 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £94.47
Size: 100 ug
OR
Shipping
View Our Distributors