SHC3 antibody (70R-2562)

Rabbit polyclonal SHC3 antibody

Synonyms Polyclonal SHC3 antibody, Anti-SHC3 antibody, SHC 3 antibody, SHCC antibody, SHC3, SHC-3, SHC 3, Src Homology 2 Domain Containing Transforming Protein 3 antibody, NSHC antibody, N-Shc antibody, SHC-3 antibody, Src homology 2 domain containing transforming protein 3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SHC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST
Assay Information SHC3 Blocking Peptide, catalog no. 33R-8036, is also available for use as a blocking control in assays to test for specificity of this SHC3 antibody

Images

Western Blot analysis using SHC3 antibody (70R-2562)

SHC3 antibody (70R-2562) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SHC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SHC3 antibody (70R-2562) | SHC3 antibody (70R-2562) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors