SILV antibody (70R-1896)

Rabbit polyclonal SILV antibody

Synonyms Polyclonal SILV antibody, Anti-SILV antibody, SI antibody, D12S53E antibody, Silver Homolog antibody, SIL antibody, ME20 antibody, PMEL17 antibody, gp100 antibody
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
Assay Information SILV Blocking Peptide, catalog no. 33R-3727, is also available for use as a blocking control in assays to test for specificity of this SILV antibody


Immunohistochemical staining using SILV antibody (70R-1896)

SILV antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SILV antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SILV antibody (70R-1896) | SILV antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SILV antibody (70R-1896) | SILV antibody (70R-1896) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SILV antibody (70R-1896) | SILV antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors