SIRT5 antibody (70R-1009)

Rabbit polyclonal SIRT5 antibody raised against the C terminal of SIRT5

Synonyms Polyclonal SIRT5 antibody, Anti-SIRT5 antibody, SIRT-5 antibody, SIRT 5, SIRT-5, Sirtuin antibody, SIRT 5 antibody, Silent Mating Type Information Regulation 2 homolog antibody, SIRT5
Specificity SIRT5 antibody was raised against the C terminal of SIRT5
Cross Reactivity Human
Applications WB
Immunogen SIRT5 antibody was raised using the C terminal of SIRT5 corresponding to a region with amino acids HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS
Assay Information SIRT5 Blocking Peptide, catalog no. 33R-3698, is also available for use as a blocking control in assays to test for specificity of this SIRT5 antibody

Images

Western blot analysis using SIRT5 antibody (70R-1009)

Recommended SIRT5 Antibody Titration: 5.0ug/ml

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SIRT5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SIRT5 antibody (70R-1009) | Recommended SIRT5 Antibody Titration: 5.0ug/ml
  • Western blot analysis using SIRT5 antibody (70R-1009) | Human Liver lysate

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors