SLC12A1 antibody (70R-3806)

Rabbit polyclonal SLC12A1 antibody

Synonyms Polyclonal SLC12A1 antibody, Anti-SLC12A1 antibody, SLC12A1, MGC48843 antibody, SLCA1 12, Solute Carrier Family 12 Sodium/Potassium/Chloride Transporters Member 1 antibody, SLCA1-12, NKCC2 antibody, BSC1 antibody, SLCA1 12 antibody, Sodium/Potassium/Chloride Transporters 1 antibody, SLCA1-12 antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen SLC12A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Assay Information SLC12A1 Blocking Peptide, catalog no. 33R-6671, is also available for use as a blocking control in assays to test for specificity of this SLC12A1 antibody

Images

Immunohistochemical staining using SLC12A1 antibody (70R-3806)

SLC12A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC12A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC12A1 antibody (70R-3806) | SLC12A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC12A1 antibody (70R-3806) | SLC12A1 antibody (70R-3806) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
OR
Shipping
View Our Distributors