SLC16A8 antibody (70R-1793)

Rabbit polyclonal SLC16A8 antibody

Synonyms Polyclonal SLC16A8 antibody, Anti-SLC16A8 antibody, SLC16A8, SLCA8 16 antibody, Solute Carrier Family 16 Member 8 antibody, SLCA8-16, SLCA8-16 antibody, SLCA8 16, MCT3 antibody, Monocarboxylic Acid Transporter 3 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC16A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
Assay Information SLC16A8 Blocking Peptide, catalog no. 33R-7805, is also available for use as a blocking control in assays to test for specificity of this SLC16A8 antibody


Immunohistochemical staining using SLC16A8 antibody (70R-1793)

SLC16A8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC16A8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC16A8 antibody (70R-1793) | SLC16A8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC16A8 antibody (70R-1793) | SLC16A8 antibody (70R-1793) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors