SLC1A5 antibody (70R-1769)

Rabbit polyclonal SLC1A5 antibody

Synonyms Polyclonal SLC1A5 antibody, Anti-SLC1A5 antibody, SLCA5-1, Neutral Amino Acid Transporter 5 antibody, AAAT antibody, ASCT2 antibody, SLC1A5, SLCA5-1 antibody, M7V1 antibody, Solute Carrier Family 1 Neutral Amino Acid Transporter Member 5 antibody, SLCA5 1 antibody, M7VS1 antibody, RDRC antibody, ATBO antibody, R16 antibody, FLJ31068 antibody, SLCA5 1
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
Assay Information SLC1A5 Blocking Peptide, catalog no. 33R-2915, is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody


Immunohistochemical staining using SLC1A5 antibody (70R-1769)

SLC1A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC1A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC1A5 antibody (70R-1769) | SLC1A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC1A5 antibody (70R-1769) | SLC1A5 antibody (70R-1769) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £252.39
Size: 100 ug
View Our Distributors