SLC25A46 antibody (70R-1747)

Rabbit polyclonal SLC25A46 antibody raised against the N terminal of SLC25A46

Synonyms Polyclonal SLC25A46 antibody, Anti-SLC25A46 antibody, SLCA46-25, SLCA46-25 antibody, SLCA46 25 antibody, SLC25A46, SLCA46 25, Solute Carrier Family 25 Member 46 antibody
Specificity SLC25A46 antibody was raised against the N terminal of SLC25A46
Cross Reactivity Human,Mouse,Rat,ZebraFish
Applications WB
Immunogen SLC25A46 antibody was raised using the N terminal of SLC25A46 corresponding to a region with amino acids RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP
Assay Information SLC25A46 Blocking Peptide, catalog no. 33R-8179, is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody


Western Blot analysis using SLC25A46 antibody (70R-1747)

SLC25A46 antibody (70R-1747) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC25A46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC25A46 antibody (70R-1747) | SLC25A46 antibody (70R-1747) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors