SLC26A5 antibody (70R-1782)

Rabbit polyclonal SLC26A5 antibody

Synonyms Polyclonal SLC26A5 antibody, Anti-SLC26A5 antibody, Prestin antibody, SLCA5 26 antibody, SLCA5-26 antibody, MGC118887 antibody, DFNB61 antibody, Solute Carrier Family 26 Member 5 antibody, MGC118886 antibody, MGC118888 antibody, MGC118889 antibody, PRES antibody, SLC26A5, SLCA5 26, SLCA5-26
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen SLC26A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS
Assay Information SLC26A5 Blocking Peptide, catalog no. 33R-3083, is also available for use as a blocking control in assays to test for specificity of this SLC26A5 antibody


Immunohistochemical staining using SLC26A5 antibody (70R-1782)

SLC26A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC26A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC26A5 antibody (70R-1782) | SLC26A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SLC26A5 antibody (70R-1782) | SLC26A5 antibody (70R-1782) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SLC26A5 antibody (70R-1782) | SLC26A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors