SLC35B1 antibody (70R-1849)

Rabbit polyclonal SLC35B1 antibody raised against the C terminal of SLC35B1

Synonyms Polyclonal SLC35B1 antibody, Anti-SLC35B1 antibody, SLCB1-35, SLC35B1, SLCB1 35 antibody, UGTREL1 antibody, SLCB1-35 antibody, Solute Carrier Family 35 Member B1 antibody, SLCB1 35
Specificity SLC35B1 antibody was raised against the C terminal of SLC35B1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SLC35B1 antibody was raised using the C terminal of SLC35B1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT
Assay Information SLC35B1 Blocking Peptide, catalog no. 33R-1334, is also available for use as a blocking control in assays to test for specificity of this SLC35B1 antibody

Images

Western Blot analysis using SLC35B1 antibody (70R-1849)

SLC35B1 antibody (70R-1849) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC35B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC35B1 antibody (70R-1849) | SLC35B1 antibody (70R-1849) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors