SLC35C1 antibody (70R-1723)

Rabbit polyclonal SLC35C1 antibody raised against the N terminal of SLC35C1

Synonyms Polyclonal SLC35C1 antibody, Anti-SLC35C1 antibody, SLCC1-35, FLJ11320 antibody, SLCC1-35 antibody, SLCC1 35, SLC35C1, FUCT1 antibody, SLCC1 35 antibody, Solute Carrier Family 35 Member C1 antibody, FLJ14841 antibody
Specificity SLC35C1 antibody was raised against the N terminal of SLC35C1
Cross Reactivity Human
Applications WB
Immunogen SLC35C1 antibody was raised using the N terminal of SLC35C1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
Assay Information SLC35C1 Blocking Peptide, catalog no. 33R-9287, is also available for use as a blocking control in assays to test for specificity of this SLC35C1 antibody


Western Blot analysis using SLC35C1 antibody (70R-1723)

SLC35C1 antibody (70R-1723) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC35C1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC35C1 antibody (70R-1723) | SLC35C1 antibody (70R-1723) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors