SLC35F2 antibody (70R-1795)

Rabbit polyclonal SLC35F2 antibody raised against the N terminal of SLC35F2

Synonyms Polyclonal SLC35F2 antibody, Anti-SLC35F2 antibody, FLJ13018 antibody, HSNOV1 antibody, SLC35F2, DKFZp667H1615 antibody, SLCF2-35, SLCF2 35, SLCF2 35 antibody, Solute Carrier Family 35 Member F2 antibody, SLCF2-35 antibody
Specificity SLC35F2 antibody was raised against the N terminal of SLC35F2
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC35F2 antibody was raised using the N terminal of SLC35F2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS
Assay Information SLC35F2 Blocking Peptide, catalog no. 33R-5885, is also available for use as a blocking control in assays to test for specificity of this SLC35F2 antibody


Western Blot analysis using SLC35F2 antibody (70R-1795)

SLC35F2 antibody (70R-1795) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC35F2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35F2 is a putative solute transporter.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC35F2 antibody (70R-1795) | SLC35F2 antibody (70R-1795) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SLC35F2 antibody (70R-1795) | SLC35F2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors