SLC38A1 antibody (70R-1755)

Rabbit polyclonal SLC38A1 antibody raised against the middle region of SLC38A1

Synonyms Polyclonal SLC38A1 antibody, Anti-SLC38A1 antibody, SLCA1 38, SLCA1-38 antibody, ATA1 antibody, NAT2 antibody, SLCA1-38, SLC38A1, Solute Carrier Family 38 Member 1 antibody, SLCA1 38 antibody, SAT1 antibody, SNAT1 antibody
Specificity SLC38A1 antibody was raised against the middle region of SLC38A1
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC38A1 antibody was raised using the middle region of SLC38A1 corresponding to a region with amino acids DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD
Assay Information SLC38A1 Blocking Peptide, catalog no. 33R-2150, is also available for use as a blocking control in assays to test for specificity of this SLC38A1 antibody

Images

Western Blot analysis using SLC38A1 antibody (70R-1755)

SLC38A1 antibody (70R-1755) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC38A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC38A1 antibody (70R-1755) | SLC38A1 antibody (70R-1755) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors