SLC41A2 antibody (70R-1762)

Rabbit polyclonal SLC41A2 antibody raised against the N terminal of SLC41A2

Synonyms Polyclonal SLC41A2 antibody, Anti-SLC41A2 antibody, MGC125330 antibody, Solute Carrier Family 41 Member 2 antibody, SLCA2 41, SLC41A2, SLC41A1-L1 antibody, SLCA2-41 antibody, SLCA2 41 antibody, SLCA2-41, MGC125331 antibody, DKFZP434K0427 antibody
Specificity SLC41A2 antibody was raised against the N terminal of SLC41A2
Cross Reactivity Human
Applications WB
Immunogen SLC41A2 antibody was raised using the N terminal of SLC41A2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK
Assay Information SLC41A2 Blocking Peptide, catalog no. 33R-8340, is also available for use as a blocking control in assays to test for specificity of this SLC41A2 antibody


Western Blot analysis using SLC41A2 antibody (70R-1762)

SLC41A2 antibody (70R-1762) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC41A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC41A2 acts as a plasma-membrane magnesium transporter.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC41A2 antibody (70R-1762) | SLC41A2 antibody (70R-1762) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors