SLC46A3 antibody (70R-1855)

Rabbit polyclonal SLC46A3 antibody raised against the N terminal of SLC46A3

Synonyms Polyclonal SLC46A3 antibody, Anti-SLC46A3 antibody, SLCA3 46, Solute Carrier Family 46 Member 3 antibody, FKSG16 antibody, SLC46A3, SLCA3-46, SLCA3-46 antibody, SLCA3 46 antibody
Specificity SLC46A3 antibody was raised against the N terminal of SLC46A3
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC46A3 antibody was raised using the N terminal of SLC46A3 corresponding to a region with amino acids MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC
Assay Information SLC46A3 Blocking Peptide, catalog no. 33R-6144, is also available for use as a blocking control in assays to test for specificity of this SLC46A3 antibody


Immunohistochemical staining using SLC46A3 antibody (70R-1855)

SLC46A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC46A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SLC46A3 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC46A3 antibody (70R-1855) | SLC46A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC46A3 antibody (70R-1855) | SLC46A3 antibody (70R-1855) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors