SLC5A4 antibody (70R-1794)

Rabbit polyclonal SLC5A4 antibody

Synonyms Polyclonal SLC5A4 antibody, Anti-SLC5A4 antibody, SAAT1 antibody, SLCA4 5 antibody, SLC5A4, SLCA4 5, SGLT3 antibody, SLCA4-5, DJ90G24.4 antibody, SLCA4-5 antibody, Low Affinity Glucose Cotransporter 4 antibody, Solute Carrier Family 5 Member 4 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
Assay Information SLC5A4 Blocking Peptide, catalog no. 33R-5766, is also available for use as a blocking control in assays to test for specificity of this SLC5A4 antibody


Western Blot analysis using SLC5A4 antibody (70R-1794)

SLC5A4 antibody (70R-1794) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC5A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC5A4 antibody (70R-1794) | SLC5A4 antibody (70R-1794) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors