SLC6A18 antibody (70R-1802)

Rabbit polyclonal SLC6A18 antibody raised against the middle region of SLC6A18

Synonyms Polyclonal SLC6A18 antibody, Anti-SLC6A18 antibody, Solute Carrier Family 6 Member 18 antibody, FLJ31236 antibody, SLCA18-6, Xtrp2 antibody, SLCA18 6, SLCA18 6 antibody, SLCA18-6 antibody, SLC6A18
Specificity SLC6A18 antibody was raised against the middle region of SLC6A18
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen SLC6A18 antibody was raised using the middle region of SLC6A18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
Assay Information SLC6A18 Blocking Peptide, catalog no. 33R-6097, is also available for use as a blocking control in assays to test for specificity of this SLC6A18 antibody

Images

Immunohistochemical staining using SLC6A18 antibody (70R-1802)

SLC6A18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC6A18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The SLC6 family of proteins, which includes SLC6A18, acts as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC6A18 antibody (70R-1802) | SLC6A18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC6A18 antibody (70R-1802) | SLC6A18 antibody (70R-1802) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors