SLC6A8 antibody (70R-1836)

Rabbit polyclonal SLC6A8 antibody

Synonyms Polyclonal SLC6A8 antibody, Anti-SLC6A8 antibody, SLCA8-6, SLC6A8, MGC87396 antibody, SLCA8 6, CT1 antibody, SLCA8-6 antibody, Solute Carrier Family 6 Member 8 antibody, Neurotransmitter Transporter Creatine 8 antibody, CRTR antibody, SLCA8 6 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
Assay Information SLC6A8 Blocking Peptide, catalog no. 33R-1670, is also available for use as a blocking control in assays to test for specificity of this SLC6A8 antibody


Immunohistochemical staining using SLC6A8 antibody (70R-1836)

SLC6A8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC6A8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC6A8 is required for the uptake of creatine in muscles and brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC6A8 antibody (70R-1836) | SLC6A8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows)  in Human Muscle. Magnification is at 400X
  • Western Blot analysis using SLC6A8 antibody (70R-1836) | SLC6A8 antibody (70R-1836) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £252.39
Size: 100 ug
View Our Distributors