SLIT1 antibody (70R-5296)

Rabbit polyclonal SLIT1 antibody

Synonyms Polyclonal SLIT1 antibody, Anti-SLIT1 antibody, Slit Homolog 1 antibody, SLIL1 antibody, MEGF4 antibody, SLIT3 antibody, Slit-1 antibody
Cross Reactivity Human
Applications WB
Immunogen SLIT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
Assay Information SLIT1 Blocking Peptide, catalog no. 33R-3156, is also available for use as a blocking control in assays to test for specificity of this SLIT1 antibody

Images

Immunofluorescent staining using SLIT1 antibody (70R-5296)

SLIT1 antibody used at a concentration of 2 and 10 ug/ml to detect gut tissue. Goat anti-Rabbit (Cy3) was used at 1:500.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 168 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLIT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunofluorescent staining using SLIT1 antibody (70R-5296) | SLIT1 antibody used at a concentration of 2 and 10 ug/ml to detect gut tissue. Goat anti-Rabbit (Cy3) was used at 1:500.
  • Western Blot analysis using SLIT1 antibody (70R-5296) | SLIT1 antibody (70R-5296) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors