SLU7 antibody (70R-4126)

Rabbit polyclonal SLU7 antibody

Synonyms Polyclonal SLU7 antibody, Anti-SLU7 antibody, 9G8 antibody, SLU 7 antibody, Slu7 Splicing Factor Homolog antibody, SLU7, SLU-7, hSlu7 antibody, SLU-7 antibody, SLU 7, MGC9280 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLU7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH
Assay Information SLU7 Blocking Peptide, catalog no. 33R-4475, is also available for use as a blocking control in assays to test for specificity of this SLU7 antibody


Western Blot analysis using SLU7 antibody (70R-4126)

SLU7 antibody (70R-4126) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLU7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is a splicing factor that has been found to be essential during the second catalytic step in the pre-mRNA splicing process.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLU7 antibody (70R-4126) | SLU7 antibody (70R-4126) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors