SMC2 antibody (70R-2053)

Rabbit polyclonal SMC2 antibody raised against the N terminal of SMC2

Synonyms Polyclonal SMC2 antibody, Anti-SMC2 antibody, SMC-2, SMC-2 antibody, SMC 2 antibody, SMC2, SMC 2, Structural Maintenance Of Chromosomes 2 antibody
Specificity SMC2 antibody was raised against the N terminal of SMC2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SMC2 antibody was raised using the N terminal of SMC2 corresponding to a region with amino acids ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE
Assay Information SMC2 Blocking Peptide, catalog no. 33R-4161, is also available for use as a blocking control in assays to test for specificity of this SMC2 antibody

Images

Western Blot analysis using SMC2 antibody (70R-2053)

SMC2 antibody (70R-2053) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMC2 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SMC2 antibody (70R-2053) | SMC2 antibody (70R-2053) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors