SMC2 antibody (70R-5610)

Rabbit polyclonal SMC2 antibody raised against the middle region of SMC2

Synonyms Polyclonal SMC2 antibody, Anti-SMC2 antibody, SMC 2, SMC-2 antibody, SMC-2, SMC2, FLJ10093 antibody, CAPE antibody, hCAP-E antibody, SMC 2 antibody, CAP-E antibody, Structural Maintenance Of Chromosomes 2 antibody, SMC2L1 antibody
Specificity SMC2 antibody was raised against the middle region of SMC2
Cross Reactivity Human,Rat
Applications WB
Immunogen SMC2 antibody was raised using the middle region of SMC2 corresponding to a region with amino acids ATLAGQMMACKNDISKAQTEAKQAQMKLKHAQQELKNKQAEVKKMDSGYR
Assay Information SMC2 Blocking Peptide, catalog no. 33R-1563, is also available for use as a blocking control in assays to test for specificity of this SMC2 antibody

Images

Western Blot analysis using SMC2 antibody (70R-5610)

SMC2 antibody (70R-5610) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 136 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMC2 belongs to the SMC family. It is a central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SMC2 antibody (70R-5610) | SMC2 antibody (70R-5610) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors