SMPX antibody (70R-1186)

Rabbit polyclonal SMPX antibody raised against the middle region of SMPX

Synonyms Polyclonal SMPX antibody, Anti-SMPX antibody, Small Muscle Protein X-Linked antibody
Specificity SMPX antibody was raised against the middle region of SMPX
Cross Reactivity Human,Dog
Applications WB
Immunogen SMPX antibody was raised using the middle region of SMPX corresponding to a region with amino acids TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
Assay Information SMPX Blocking Peptide, catalog no. 33R-9221, is also available for use as a blocking control in assays to test for specificity of this SMPX antibody

Images

Western Blot analysis using SMPX antibody (70R-1186)

SMPX antibody (70R-1186) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SMPX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SMPX antibody (70R-1186) | SMPX antibody (70R-1186) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors