SMUG1 antibody (70R-2095)

Rabbit polyclonal SMUG1 antibody raised against the middle region of SMUG1

Synonyms Polyclonal SMUG1 antibody, Anti-SMUG1 antibody, UNG3 antibody, SMUG 1 antibody, SMUG1, SMUG-1, Single-Strand-Selective Monofunctional Uracil-Dna Glycosylase 1 antibody, HMUDG antibody, FDG antibody, SMUG-1 antibody, SMUG 1, MGC104370 antibody
Specificity SMUG1 antibody was raised against the middle region of SMUG1
Cross Reactivity Human,Mouse
Applications WB
Immunogen SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC
Assay Information SMUG1 Blocking Peptide, catalog no. 33R-4200, is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody

Images

Western Blot analysis using SMUG1 antibody (70R-2095)

SMUG1 antibody (70R-2095) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMUG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SMUG1 antibody (70R-2095) | SMUG1 antibody (70R-2095) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors