SNF1LK antibody (70R-1185)

Rabbit polyclonal SNF1LK antibody raised against the N terminal of SNF1LK

Synonyms Polyclonal SNF1LK antibody, Anti-SNF1LK antibody, SNFLK 1, SIK antibody, SNFLK-1 antibody, SNFLK 1 antibody, MSK antibody, Snf1-Like Kinase antibody, SNF1LK, SNFLK-1
Specificity SNF1LK antibody was raised against the N terminal of SNF1LK
Cross Reactivity Human
Applications IHC, WB
Immunogen SNF1LK antibody was raised using the N terminal of SNF1LK corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
Assay Information SNF1LK Blocking Peptide, catalog no. 33R-6587, is also available for use as a blocking control in assays to test for specificity of this SNF1LK antibody


Western Blot analysis using SNF1LK antibody (70R-1185)

SNF1LK antibody (70R-1185) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SNF1LK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SNF1LK antibody (70R-1185) | SNF1LK antibody (70R-1185) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SNF1LK antibody (70R-1185) | SNF1LK antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Surface mucous cells and Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors