SNRK antibody (70R-2565)

Rabbit polyclonal SNRK antibody raised against the middle region of SNRK

Synonyms Polyclonal SNRK antibody, Anti-SNRK antibody, KIAA0096 antibody, DKFZp779A1866 antibody, FLJ20224 antibody, Snf Related Kinase antibody, HSNFRK antibody
Specificity SNRK antibody was raised against the middle region of SNRK
Cross Reactivity Human,Rat
Applications WB
Immunogen SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN
Assay Information SNRK Blocking Peptide, catalog no. 33R-8848, is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Images

Western Blot analysis using SNRK antibody (70R-2565)

SNRK antibody (70R-2565) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SNRK antibody (70R-2565) | SNRK antibody (70R-2565) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors