SNRPA antibody (70R-4992)

Rabbit polyclonal SNRPA antibody raised against the middle region of SNRPA

Synonyms Polyclonal SNRPA antibody, Anti-SNRPA antibody, Small Nuclear Ribonucleoprotein Polypeptide A antibody
Specificity SNRPA antibody was raised against the middle region of SNRPA
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
Assay Information SNRPA Blocking Peptide, catalog no. 33R-6281, is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody

Images

Immunohistochemical staining using SNRPA antibody (70R-4992)

SNRPA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SNRPA antibody (70R-4992) | SNRPA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.
  • Western Blot analysis using SNRPA antibody (70R-4992) | SNRPA antibody (70R-4992) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors