SNRPA1 antibody (70R-4716)

Rabbit polyclonal SNRPA1 antibody raised against the N terminal of SNRPA1

Synonyms Polyclonal SNRPA1 antibody, Anti-SNRPA1 antibody, Small Nuclear Ribonucleoprotein Polypeptide A antibody
Specificity SNRPA1 antibody was raised against the N terminal of SNRPA1
Cross Reactivity Human,Mouse
Applications WB
Immunogen SNRPA1 antibody was raised using the N terminal of SNRPA1 corresponding to a region with amino acids VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD
Assay Information SNRPA1 Blocking Peptide, catalog no. 33R-9630, is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Images

Western Blot analysis using SNRPA1 antibody (70R-4716)

SNRPA1 antibody (70R-4716) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SNRPA1 antibody (70R-4716) | SNRPA1 antibody (70R-4716) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors