SNRPD1 antibody (70R-4701)

Rabbit polyclonal SNRPD1 antibody raised against the N terminal of SNRPD1

Synonyms Polyclonal SNRPD1 antibody, Anti-SNRPD1 antibody, Small Nuclear Ribonucleoprotein D1 Polypeptide 16Kda antibody
Specificity SNRPD1 antibody was raised against the N terminal of SNRPD1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
Assay Information SNRPD1 Blocking Peptide, catalog no. 33R-6711, is also available for use as a blocking control in assays to test for specificity of this SNRPD1 antibody

Images

Immunohistochemical staining using SNRPD1 antibody (70R-4701)

SNRPD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRPD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SNRPD1 antibody (70R-4701) | SNRPD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SNRPD1 antibody (70R-4701) | SNRPD1 antibody (70R-4701) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
OR
Shipping
View Our Distributors