SNRPF antibody (70R-1423)

Rabbit polyclonal SNRPF antibody raised against the N terminal of SNRPF

Synonyms Polyclonal SNRPF antibody, Anti-SNRPF antibody, Small Nuclear Ribonucleoprotein Polypeptide F antibody
Specificity SNRPF antibody was raised against the N terminal of SNRPF
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY
Assay Information SNRPF Blocking Peptide, catalog no. 33R-6466, is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody


Immunohistochemical staining using SNRPF antibody (70R-1423)

SNRPF antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SNRPF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.31 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SNRPF antibody (70R-1423) | SNRPF antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X
  • Western Blot analysis using SNRPF antibody (70R-1423) | SNRPF antibody (70R-1423) used at 0.31 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors