SNUPN antibody (70R-4636)

Rabbit polyclonal SNUPN antibody raised against the middle region of SNUPN

Synonyms Polyclonal SNUPN antibody, Anti-SNUPN antibody, Snurportin 1 antibody, Snurportin1 antibody, RNUT1 antibody, KPNBL antibody
Specificity SNUPN antibody was raised against the middle region of SNUPN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL
Assay Information SNUPN Blocking Peptide, catalog no. 33R-3628, is also available for use as a blocking control in assays to test for specificity of this SNUPN antibody


Western Blot analysis using SNUPN antibody (70R-4636)

SNUPN antibody (70R-4636) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNUPN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SNUPN antibody (70R-4636) | SNUPN antibody (70R-4636) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors