SOD1 antibody (70R-1548)

Rabbit polyclonal SOD1 antibody raised against the N terminal of SOD1

Synonyms Polyclonal SOD1 antibody, Anti-SOD1 antibody, SOD antibody, ALS1 antibody, Superoxide Dismutase 1 Soluble antibody, ALS antibody, IPOA antibody, Amyotrophic Lateral Sclerosis 1 antibody, homodimer antibody
Specificity SOD1 antibody was raised against the N terminal of SOD1
Cross Reactivity Human
Applications IHC, WB
Immunogen SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
Assay Information SOD1 Blocking Peptide, catalog no. 33R-5777, is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody

Images

Immunohistochemical staining using SOD1 antibody (70R-1548)

SOD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SOD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SOD1 antibody (70R-1548) | SOD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SOD1 antibody (70R-1548) | SOD1 antibody (70R-1548) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SOD1 antibody (70R-1548) | SOD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows)  in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors