SPATA16 antibody (70R-3856)

Rabbit polyclonal SPATA16 antibody raised against the N terminal of SPATA16

Synonyms Polyclonal SPATA16 antibody, Anti-SPATA16 antibody, SPATA-16 antibody, SPATA 16, Spermatogenesis Associated 16 antibody, SPATA-16, SPATA16, NYD-SP12 antibody, SPATA 16 antibody
Specificity SPATA16 antibody was raised against the N terminal of SPATA16
Cross Reactivity Human
Applications WB
Immunogen SPATA16 antibody was raised using the N terminal of SPATA16 corresponding to a region with amino acids MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN
Assay Information SPATA16 Blocking Peptide, catalog no. 33R-5820, is also available for use as a blocking control in assays to test for specificity of this SPATA16 antibody


Western Blot analysis using SPATA16 antibody (70R-3856)

SPATA16 antibody (70R-3856) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPATA16 is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. Defects in SPATA16 are a cause of globozoospermia; also called Round-headed spermatozoa.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPATA16 antibody (70R-3856) | SPATA16 antibody (70R-3856) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors