SPATA24 antibody (70R-4050)

Rabbit polyclonal SPATA24 antibody raised against the c terminal of SPATA24

Synonyms Polyclonal SPATA24 antibody, Anti-SPATA24 antibody, T6441 antibody, SPATA -24 antibody, CCDC161 antibody, SPATA 24, SPATA 24 antibody, SPATA -24, SPATA24 antibody, SPATA24, Spermatogenesis Associated 24 antibody
Specificity SPATA24 antibody was raised against the c terminal of SPATA24
Cross Reactivity Human
Applications WB
Immunogen SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ
Assay Information SPATA24 Blocking Peptide, catalog no. 33R-5332, is also available for use as a blocking control in assays to test for specificity of this SPATA24 antibody

Images

Western Blot analysis using SPATA24 antibody (70R-4050)

SPATA24 antibody (70R-4050) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPATA24  antibody (70R-4050) | SPATA24 antibody (70R-4050) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors